PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G38620.1
Common NameATMYB4, F20M13.180, MYB4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 282aa    MW: 31808.4 Da    PI: 8.7595
Description myb domain protein 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G38620.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv ++k +G g+W++ ++  g+ R++k+c++rw +yl
      AT4G38620.1 14 KGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding59.95.4e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
      AT4G38620.1  67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.051961IPR017930Myb domain
SuperFamilySSF466893.95E-3013108IPR009057Homeodomain-like
SMARTSM007178.5E-141363IPR001005SANT/Myb domain
PfamPF002493.2E-151461IPR001005SANT/Myb domain
CDDcd001671.11E-101661No hitNo description
PROSITE profilePS5129429.41162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2865117IPR009057Homeodomain-like
SMARTSM007176.3E-1866114IPR001005SANT/Myb domain
PfamPF002493.6E-1767111IPR001005SANT/Myb domain
CDDcd001674.67E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010224Biological Processresponse to UV-B
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0090379Biological Processsecondary cell wall biogenesis involved in seed trichome differentiation
GO:1903086Biological Processnegative regulation of sinapate ester biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDERLVAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLINRG  120
IDPTSHRPIQ ESSASQDSKP TQLEPVTSNT INISFTSAPK VETFHESISF PGKSEKISML  180
TFKEEKDECP VQEKFPDLNL ELRISLPDDV DRLQGHGKST TPRCFKCSLG MINGMECRCG  240
RMRCDVVGGS SKGSDMSNGF DFLGLAKKET TSLLGFRSLE MK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.205210.0cell culture| flower| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306920300.0
Genevisible252958_at0.0
Expression AtlasAT4G38620-
AtGenExpressAT4G38620-
ATTED-IIAT4G38620-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269|PubMed:9839469}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a R2R3 MYB protein which is involved in the response to UV-B. It functions as a repressor of target gene expression. One of its target genes encodes cinnamate 4-hydroxylase; mutants accumulate sinapate esters in their leaves. MYB4 binds to its own promoter and represses its own expression. Nuclear localization of MYB4 depends on the action of the beta importin SAD2.
UniProtTranscription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}.
Function -- GeneRIF ? help Back to Top
  1. Arabidopsis thaliana mutant sensitive to ABA and drought2 (sad2), which harbors a T-DNA insertion in an importin beta-like gene, is more tolerant to UV-B radiation than the wild type.
    [PMID: 17993626]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00479DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G38620.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT4G38620 (R)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G51680(R), AT1G65060(R), AT2G30490(R), AT3G53260(A), AT4G38620(R), AT5G13930(R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9SZP1
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Defects lead to a better tolerance of UV-B irradiation due to the increase in sinapate ester accumulation. {ECO:0000269|PubMed:11080161}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G38620
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0701000.0AY070100.1 Arabidopsis thaliana putative transcription factor MYB4 (At4g38620) mRNA, complete cds.
GenBankAY1230040.0AY123004.1 Arabidopsis thaliana putative transcription factor MYB4 (At4g38620) mRNA, complete cds.
GenBankAY1400370.0AY140037.1 Arabidopsis thaliana putative transcription factor MYB4 (At4g38620) mRNA, complete cds.
GenBankAY5196150.0AY519615.1 Arabidopsis thaliana MYB transcription factor (At4g38620) mRNA, complete cds.
GenBankBT0063020.0BT006302.1 Arabidopsis thaliana At4g38620 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195574.10.0transcription repressor MYB4
SwissprotQ9SZP10.0MYB4_ARATH; Transcription repressor MYB4
TrEMBLD7MFL70.0D7MFL7_ARALL; Putative uncharacterized protein
STRINGAT4G38620.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Jin H, et al.
    Transcriptional repression by AtMYB4 controls production of UV-protecting sunscreens in Arabidopsis.
    EMBO J., 2000. 19(22): p. 6150-61
    [PMID:11080161]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  4. Song W,Solimeo H,Rupert RA,Yadav NS,Zhu Q
    Functional dissection of a Rice Dr1/DrAp1 transcriptional repression complex.
    Plant Cell, 2002. 14(1): p. 181-95
    [PMID:11826307]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Vannini C, et al.
    Overexpression of the rice Osmyb4 gene increases chilling and freezing tolerance of Arabidopsis thaliana plants.
    Plant J., 2004. 37(1): p. 115-27
    [PMID:14675437]
  7. Gong W, et al.
    Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes.
    Plant Physiol., 2004. 135(2): p. 773-82
    [PMID:15208423]
  8. Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF
    Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins.
    Plant J., 2004. 40(1): p. 22-34
    [PMID:15361138]
  9. Preston J,Wheeler J,Heazlewood J,Li SF,Parish RW
    AtMYB32 is required for normal pollen development in Arabidopsis thaliana.
    Plant J., 2004. 40(6): p. 979-95
    [PMID:15584962]
  10. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  11. Zhao J, et al.
    SAD2, an importin -like protein, is required for UV-B response in Arabidopsis by mediating MYB4 nuclear trafficking.
    Plant Cell, 2007. 19(11): p. 3805-18
    [PMID:17993626]
  12. Lee Y,Lee HS,Lee JS,Kim SK,Kim SH
    Hormone- and light-regulated nucleocytoplasmic transport in plants: current status.
    J. Exp. Bot., 2008. 59(12): p. 3229-45
    [PMID:18678754]
  13. Pan Y, et al.
    Cytochrome P450 monooxygenases as reporters for circadian-regulated pathways.
    Plant Physiol., 2009. 150(2): p. 858-78
    [PMID:19386812]
  14. Kram BW,Xu WW,Carter CJ
    Uncovering the Arabidopsis thaliana nectary transcriptome: investigation of differential gene expression in floral nectariferous tissues.
    BMC Plant Biol., 2009. 9: p. 92
    [PMID:19604393]
  15. Colquhoun TA, et al.
    PhMYB4 fine-tunes the floral volatile signature of Petunia x hybrida through PhC4H.
    J. Exp. Bot., 2011. 62(3): p. 1133-43
    [PMID:21068208]
  16. Schenke D,B
    Crosstalk between abiotic ultraviolet-B stress and biotic (flg22) stress signalling in Arabidopsis prevents flavonol accumulation in favor of pathogen defence compound production.
    Plant Cell Environ., 2011. 34(11): p. 1849-64
    [PMID:21707654]
  17. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  18. Datta R,Sinha R,Chattopadhyay S
    Changes in leaf proteome profile of Arabidopsis thaliana in response to salicylic acid.
    J. Biosci., 2013. 38(2): p. 317-28
    [PMID:23660666]
  19. Fornal
    AtMYB7, a new player in the regulation of UV-sunscreens in Arabidopsis thaliana.
    Plant Cell Physiol., 2014. 55(3): p. 507-16
    [PMID:24319076]
  20. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  21. Romero I, et al.
    More than 80R2R3-MYB regulatory genes in the genome of Arabidopsis thaliana.
    Plant J., 1998. 14(3): p. 273-84
    [PMID:9628022]
  22. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]